PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0428s0080.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family G2-like
Protein Properties Length: 360aa    MW: 40428.4 Da    PI: 7.023
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0428s0080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.32.6e-31222277156
                 G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                             k+r++W+peLH+ Fv+a+++LGG ++AtPk+i+e+m+v+gLt+++vkSHLQkYRl+
  SapurV1A.0428s0080.1.p 222 KQRRCWSPELHRFFVDALQHLGGCQVATPKQIREFMQVDGLTNDEVKSHLQKYRLH 277
                             79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.625219279IPR017930Myb domain
SuperFamilySSF466894.93E-18219280IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-28221280IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-26222277IPR006447Myb domain, plants
PfamPF002494.7E-7224275IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MELSLDLSLV YVPKAIGECL KEVSMVKDGS QKLPNLDDYV KRLEDERRKI DAFKRELPLC  60
MLLLNEAIIR LKEEAMQCKE LNALVPLKGG SNEDGSDKKN WMSSVQLWNT NKNINLDCKN  120
QDTRSEPKQR SEEDDDRSTC ENPIQLGNHG NKEGASLPFK TLSGFVRSKK KEEKEVVSQV  180
TGLSLMTPVP ESCNFMSKSN NCGNQMKIQS KSQQQQQHAY RKQRRCWSPE LHRFFVDALQ  240
HLGGCQVATP KQIREFMQVD GLTNDEVKSH LQKYRLHLRK VPGSSATPAN GLWKSQDQCE  300
DPAMHNNPES NSQKAPLQGS SSGKATTNTG GDSMEAEDDD KSESHSWNGV LYHPGEVHV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011009272.10.0PREDICTED: uncharacterized protein LOC105114429
TrEMBLB9HE750.0B9HE75_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11470.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.13e-69G2-like family protein